PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00121626001
Common NameGSBRNA2T00121626001, LOC106436165, LOC106439593
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 243aa    MW: 26954.2 Da    PI: 9.7192
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00121626001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.93.9e-373897362
               zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         +  lkcprCds ntkfCyynnyslsqPr++Ck+CrryWt+GG+lrnvP+Gg++r+++k s
  GSBRNA2T00121626001 38 QPVLKCPRCDSVNTKFCYYNNYSLSQPRHYCKNCRRYWTRGGSLRNVPIGGSTRNKNKPS 97
                         56789*************************************************988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-303595IPR003851Zinc finger, Dof-type
PfamPF027017.1E-324095IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.1744195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MMTSSHQSHT TSFNPRRIKA KAKPPHQISR MGPSPAAQPV LKCPRCDSVN TKFCYYNNYS  60
LSQPRHYCKN CRRYWTRGGS LRNVPIGGST RNKNKPSSLQ VISSPPPIVA SLSSHELVDG  120
FRMNRAMIDP PATAFPGGFS GYMFSLDPTY NLASSSIESL SSLNQDLHQK LQQQRLFTSM  180
FQQDSPPVMF HNVELLPPST ATTEWAFDRS AIGGATSGSN ENNGEREGNL ESWYYNPNNS  240
MP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.147510.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00121626001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2286132e-43AK228613.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL15-43-I22.
GenBankAL0355382e-43AL035538.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F20D10 (ESSA project).
GenBankAL1615922e-43AL161592.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 88.
GenBankBT0057672e-43BT005767.1 Arabidopsis thaliana clone RAFL15-43-I22 (R20996) putative Dof zinc finger protein (At4g38000) mRNA, complete cds.
GenBankBT0060922e-43BT006092.1 Arabidopsis thaliana clone U20996 putative Dof zinc finger protein (At4g38000) mRNA, complete cds.
GenBankCP0026872e-43CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013732610.10.0PREDICTED: dof zinc finger protein DOF4.7-like
RefseqXP_013736532.10.0PREDICTED: dof zinc finger protein DOF4.7-like
SwissprotQ84K521e-114DOF47_ARATH; Dof zinc finger protein DOF4.7
TrEMBLA0A078CI060.0A0A078CI06_BRANA; BnaA01g00130D protein
STRINGBra011800.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152861518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38000.18e-97DNA binding with one finger 4.7
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]